Class 14 · Experimental oncology peptides · p53-derived HDM-2 targeting · 32-AA chimera · NOT a treatment
PNC-27an experimental anticancer peptide — and an FDA-flagged product
PNC-27 is an experimental laboratory peptide studied for its ability to attach to cancer-cell membranes and rupture them in lab dishes and animals. It is not an approved cancer treatment, there is no safe consumer dose, and it has never been shown to work in people. The FDA has specifically warned the public not to use PNC-27 products sold as a cancer cure, and found bacterial contamination in an inhalable sample. Anyone facing cancer should work with a licensed oncology team — this page exists to document the science and the warnings, not to guide use.
A 32-residue chimeric peptide fusing the p53 residues 12–26 HDM-2/MDM-2-binding domain to a penetratin-like membrane-residency leader. The leading preclinical model is selective lysis of cancer cells via membrane-associated HDM-2 pore formation and necrosis, with relative sparing of normal cells in tested systems. There is no FDA-approved indication, no validated human PK or dose, and an active FDA consumer warning plus a documented product-contamination finding. Its place here is as a research-only candidate, not a clinician-ready protocol.
PNC-27 — PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (C₁₈₈H₂₉₃N₅₃O₄₄S, MW ≈ 4031.7 Da, CAS 1159861-00-3, PubChem SID 505189537) — p53(12–26) fused C-terminally to a membrane-residency/penetratin-like sequence. 2D-NMR and modeling show the p53 residues adopt an HDM-2-binding conformation superimposable on the p53–HDM-2 complex; PNC-27 binds membrane HDM-2 in cancer cells and assembles pore-like complexes causing membranolysis. Newer work proposes a secondary intracellular/mitochondrial-disruption branch. Evidence is in-vitro/ex-vivo/animal only.
Not approvedNo FDA-approved indication · FDA warning
PreclinicalIn vitro / ex vivo / animal only
No human doseNo validated PK · no dose-ranging trial
PNC-27 is one of the more mechanistically interesting experimental anticancer peptides: a p53-derived sequence engineered to target HDM-2/MDM-2 on cancer-cell membranes and rupture them. But "mechanistically interesting in a dish" is a world away from "a cancer treatment." There is no human trial evidence, no validated dose, no approved route, and an active FDA warning against products sold as a PNC-27 cancer cure. This entry documents the biology honestly while making the regulatory and safety reality unmistakable.
🔬
Primary use case
Lab research
Researched as a membrane-active anticancer peptide targeting membrane-associated HDM-2/MDM-2 in cancer cells — a research tool, not a therapy. Grade P.
🎯
Mechanism headline
Membrane lysis
Proposed selective cancer-cell membrane lysis via PNC-27/HDM-2 pore-like complexes, causing rapid necrosis rather than apoptosis. Grade P.
📊
Strongest evidence tier
Preclinical only
Evidence is in-vitro, ex-vivo primary tumor culture, animal, and mechanistic modeling; no robust human clinical trial located. Grade P/C.
🚫
Human dose
None
No established human dose. An animal AML abstract reported 40 mg/kg/day in mice — which must NOT be translated to humans. Grade C/D.
⚠️
Key risk
Treatment delay
Patients should not substitute PNC-27 for evidence-based oncology care; contamination, infection, treatment delay, and unknown toxicity are central concerns. Grade D.
🦠
Contamination
FDA finding
An FDA lab found Variovorax paradoxus bacteria in an inhalable PNC-27 sample — a potentially life-threatening infection risk. Grade D.
🏛️
Approval status
FDA warning
Not FDA-approved for cancer or any disease; FDA warned against PNC-27 products promoted as cancer treatments. Grade D.
🧬
Molecular basis
p53 + penetratin
p53 residues 12–26 fused to a penetratin-like membrane-residency leader — a chimera, not a natural peptide. Grade P.
02 · Mechanism of action
How PNC-27 is proposed to kill cancer cells.
PNC-27's mechanism is genuinely distinctive among p53-pathway agents: rather than restoring nuclear p53 activity, it is proposed to target HDM-2/MDM-2 that sits abnormally in the cancer-cell plasma membrane, assemble pore-like complexes there, and lyse the cell by necrosis. The whole model is built on in-vitro, ex-vivo, modeling, and animal work — every node below is mechanistic or preclinical (Grade P/C), and none has been validated in humans.
Grade P
🎯
1 · Membrane HDM-2 / MDM-2 targeting
PNC-27 is designed to recognize a cancer-associated surface target and damage cancer-cell membranes.
Clinical significance: Cancer cells in several models express HDM-2/MDM-2 at or near the plasma membrane, while matched normal cells often do not show the same pattern. Significant HDM-2 was found in the membranes of a variety of cancer cells but not in several untransformed lines, and transfecting membrane-localized HDM-2 into resistant normal cells made them susceptible to PNC-27. This membrane-localization difference is the proposed basis of tumor selectivity.
Molecular detail: PNC-27 contains the p53 HDM-2-binding domain and binds the p53-binding pocket of HDM-2/MDM-2. Conformational modeling suggests a 1:1 peptide–HDM-2 complex with the penetratin-like leader pointing away from the binding interface; the p53 residues' 3D structure is superimposable on the p53-bound conformation, supporting genuine target engagement.
Grade P
🕳️
2 · Transmembrane pore formation
Instead of switching on a slow cell-death pathway, PNC-27 may punch holes in cancer-cell membranes.
Clinical significance: Studies report rapid membrane disruption and necrosis in cancer cells with relative sparing of normal cells in tested models. PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by inducing membranolysis at membrane HDM-2. The speed of killing (hours, not days) is consistent with physical membrane damage rather than a transcriptional program.
Molecular detail: PNC-27/HDM-2 complexes are proposed to assemble into pore-like structures spanning the membrane, collapsing membrane integrity. Immuno-scanning electron microscopy with anti-PNC-27 and anti-HDM-2 gold-labeled antibodies localized the peptide to membrane HDM-2 at sites of lysis; the amphipathic α-helix-loop-α-helix structure supports a pore-forming geometry.
Grade P
💥
3 · Necrosis-dominant cell death
PNC-27 appears to kill target cancer cells quickly by membrane rupture, not programmed cell death.
Clinical significance: The dominant reported phenotype is necrosis/lysis rather than apoptosis across several cancer-cell systems. The penetratin sequence is required for tumor-cell necrosis; "naked" p53 peptide without penetratin does not reproduce it. This distinguishes PNC-27 from p53-restoration and small-molecule MDM2-inhibitor strategies that drive apoptosis.
Molecular detail: PNC-27-induced cytotoxicity is reported as rapid loss of membrane integrity, extracellular leakage (e.g. LDH release), and necrotic morphology. PNC-27 acts as the intact peptide rather than as cleavage fragments, consistent with a structural membrane-lytic mechanism rather than an intracellular signaling cascade.
Grade P/C
🧩
4 · p53-independent killing hypothesis
PNC-27 may work even when a cancer's p53 pathway is abnormal.
Clinical significance: Because the proposed target is membrane-associated HDM-2/MDM-2 and physical membrane lysis, killing may not require intact nuclear p53 signaling. AML and solid-tumor studies tie killing to membrane HDM-2 expression rather than restoration of p53 transcriptional activity. If true, this would matter because many cancers carry p53 mutations that defeat p53-restoration drugs.
Molecular detail: The mechanism is framed as exploiting aberrant HDM-2 membrane localization independent of the p53 transcriptional axis. AML models describe susceptibility tracking membrane HDM-2; the hypothesis is tumor-type dependent and not established as a general clinical property.
Some newer studies suggest PNC-27 may also enter cancer cells and disrupt mitochondria.
Clinical significance: A secondary intracellular branch could amplify killing beyond surface lysis. A 2024 study reported PNC-27 can enter cancer cells and bind mitochondrial membranes, contributing to cell disruption. The relative importance of surface versus intracellular action is still being worked out.
Molecular detail: The proposed dual action is membrane-HDM-2 pore formation plus intracellular/mitochondrial membrane disruption. The hierarchy of these mechanisms is not yet defined; mitochondrial membrane association would provide a second amphipathic-peptide target consistent with PNC-27's structure.
Grade P/C
🛡️
6 · Tumor-selective sparing of normal cells
Preclinical work claims PNC-27 kills cancer cells while sparing normal cells.
Clinical significance: Ovarian, leukemia, cervical, and other cell models report cytotoxicity against malignant cells with reduced effect on matched normal cells. Cervical-cancer work reported killing of cancer cells but not normal cervical cells; ex-vivo activity was seen against primary ovarian cancer cultures. Selectivity in dishes is not a clinical safety proof.
Molecular detail: The selectivity model depends on abnormal tumor-cell membrane localization of HDM-2/MDM-2 and/or tumor-specific membrane vulnerabilities. The same study that showed normal cells lack membrane HDM-2 made them susceptible by forcing surface HDM-2 expression — strong mechanistic support, but untested as a human safety margin.
L3 · Cascade (proposed)
Proposed membranolytic cascade
🧪 PNC-27
preclinical
→
🎯 Membrane HDM-2
cancer-cell surface
→
🕳️ Pore-like complex
membrane assembly
→
💧 Permeability collapse
ion/water imbalance
→
💥 Necrotic lysis
+ mitochondrial branch
L3 · Construct anatomy
What the 32-residue chimera is made of
Segment
Source
Role
p53 residues 12–26
Human p53 tumor suppressor
HDM-2/MDM-2-binding domain
Membrane-residency leader
Penetratin-like (Antennapedia-derived)
Membrane penetration / residency
Linkage
C-terminal fusion
Leader points away from the HDM-2 interface
PNC-28 (sibling)
p53 17–26 + penetratin
Shorter analog, same necrosis concept
PNC-26 / PNC-29
Naked p53 frag / unrelated peptide
Negative controls — no necrosis
L3 · Contrast
PNC-27 vs other p53/MDM2 strategies
Strategy
Where it acts
Death mode
p53 status needed
PNC-27 (membrane peptide)
Cancer-cell membrane HDM-2
Necrosis / lysis
May be p53-independent
Nutlin-class MDM2 inhibitors
Intracellular MDM2-p53
Apoptosis
Needs functional p53
p28 / azurin peptide
Intracellular p53 stabilization
Apoptosis / arrest
p53-dependent
N-terminal CPP p53 peptides
Intracellular
p53-dependent apoptosis
Needs functional p53
03 · Regulatory status & research-only framework
Why there is no dosing protocol here.
Most peptides in this atlas carry dosing models. PNC-27 deliberately does not. It has no FDA-approved indication, no approved route, no validated human pharmacokinetics, and no dose-ranging trial — and the FDA has warned the public against PNC-27 products sold as cancer cures. The only honest "protocol" content is a route-safety framework and the regulatory facts. Nothing below is a treatment instruction; the page rule is simple — no human protocol exists.
FDA warning · do not use PNC-27 as a cancer treatment
The FDA warned consumers not to purchase or use PNC-27 products marketed as a treatment or cure for cancer; an FDA laboratory found Variovorax paradoxus bacteria in an inhalable PNC-27 sample, posing a risk of serious, potentially life-threatening infection — especially in children, the elderly, pregnant people, and the immunocompromised. The FDA has not evaluated or approved PNC-27 as safe or effective for any disease. Anyone with cancer should discuss approved options with a licensed oncology professional; do not delay proven treatment.
No validated pharmacokinetics
No reliable human half-life, Cmax, Tmax, bioavailability, clearance, or route-specific exposure profile exists for PNC-27. Online "~30 minute half-life" claims are unvalidated catalog/marketing figures. Because there is no human PK or dose-ranging data, any "dose" must be treated as not established rather than extrapolated from animal or in-vitro work.
In vitro research exposure
Cell-culture assay design · the legitimate context
Grade P
Context
Study-specific assay concentrations only (e.g. IC₅₀-style design); reported exposures are in µg/mL working concentrations over hours.
Escalation
Serial dilution under a defined laboratory protocol — not a human dose ladder.
mg vial → mg/mL stock → µM or µg/mL working concentration (assay math only).
This is the only context where "dosing" PNC-27 is appropriate — bench research, not human use. Grade P.
Assay framework
What a legitimate PNC-27 experiment measures
Endpoint
Method
What it shows
Necrosis
LDH release
Membrane rupture / lysis
Viability
MTT / live-dead
Cytotoxicity vs normal cells
Target localization
Immuno-EM / colocalization
PNC-27 at membrane HDM-2
Selectivity
Matched normal-cell controls
Cancer vs normal differential
Animal systemic models
Not human-applicable
Grade C
Reported exposure
One AML abstract reported 40 mg/kg/day in mice for two weeks — an animal-study figure, not a human dose.
Translation
Do NOT convert mg/kg mouse dosing to humans. Interspecies scaling, PK, and toxicity are unknown.
Monitoring (animal)
Weight, survival, hematology, organ toxicity in the study context.
Animal efficacy signals do not establish a human dose, route, or safety margin. Grade C.
Why mouse ≠ human
The translation gap
Unknown
Status for PNC-27
Human PK / clearance
Not established
Human maximum tolerated dose
Not established
Interspecies scaling factor
Not validated
Human off-target toxicity
Unknown
Human use — clinical trial only
No validated protocol exists outside a regulated study
Grade D
Starting dose
Not established.
Escalation / maintenance
Not established.
Setting
Any human exposure should occur only within an oncology-supervised, IRB-approved clinical trial with protocol-defined dosing, monitoring, and stopping rules.
Risks
Unknown sterility, infusion reaction, infection, and unknown toxicity. A case report describes massive GI hemorrhage in the setting of experimental PNC-27 therapy.
There is no self-administration protocol. Substituting PNC-27 for proven cancer therapy risks serious harm through treatment delay. Grade D.
If a patient asks · decision logic
Titration / decision logic (all roads lead to oncology)
Trigger
Action
Rationale
Patient asks about PNC-27 as cancer treatment
Refer to licensed oncology / clinical-trial pathway
Not FDA-approved; treatment delay is a major harm
Product marketed as "cancer cure"
Hard stop — do not recommend
FDA warns against unproven cancer-cure products
Non-sterile / non-GMP source
Hard stop
FDA found bacterial contamination in a PNC-27 sample
Inhaled / nebulized product
Hard stop outside a regulated trial
The contamination finding involved an inhalable product
Concurrent chemo / immunotherapy
Oncology review only
Unknown interactions; possible interference with standard care
Adverse event after any use
Stop, seek medical evaluation, report to MedWatch
FDA advises reporting serious adverse events
Marketed routes ≠ approved routes
What unapproved products have been sold as
Grade D
Reported product forms
FDA-related coverage described nebulized solution, IV solution, vaginal suppository, and rectal suppository — none of which are approved routes.
Inhaled
The contamination finding specifically involved an inhalable product — pulmonary infection risk if contaminated.
Suppository
Local irritation, infection, and unknown systemic absorption.
A route being marketed online does not make it approved, safe, or effective. These are documented as a consumer-safety warning, not as options. Grade D.
Route safety · not protocols
Route-safety framework
Route
Status
Primary concern
In vitro
Research-only
Not human dosing
Animal injection
Not human-applicable
No translation to humans
IV (human)
Not established
Sterility, infusion, infection, toxicity
Nebulized / inhaled
Not established
FDA contamination finding
Rectal / vaginal suppository
Not established
Irritation, infection, unknown absorption
SC / IM
Not established
Injection-site reaction, infection, toxicity
Dose bands · NOT ESTABLISHED
Global dose-band table — no human dose exists
Band
Human amount
Basis
Low
Not established
No human PK/PD or dose-ranging trial
Standard
Not established
No approved label; no clinical dose standard
High
Not established
An animal AML abstract reported 40 mg/kg/day in mice — not translatable to a human dose
Weight-band · DISABLED
Weight-band interpolation — blocked by design
Body weight
Dose
55 kg
Not established
65 kg
Not established
75 kg
Not established
85 kg
Not established
95 kg
Not established
105 kg
Not established
No human weight-band dosing exists for PNC-27. Do not extrapolate from mouse studies.
L3 · Reconstitution math (research only)
Concentration / Reconstitution Calculator
This calculator validates concentration and draw-volume arithmetic only — the same mg→mL math used throughout the atlas. PNC-27 has no established human dose, and these figures are NOT treatment doses. The "target amount" field is a laboratory reconstitution quantity, not a recommendation to administer PNC-27 to a person. PNC-27 is not FDA-approved and the FDA has warned against its use; cancer care belongs with a licensed oncology team.
Concentration
—
Draw volume
—
Units (U-100)
—
Aliquots/vial
—
Basis
—
04 · Combinations (preclinical only)
Reported combinations — all preclinical.
The combinations below come entirely from cell-line and ex-vivo studies. None is a clinical regimen, and none should be read as a usable protocol. They are included to map the research landscape — and every one of them carries the same overriding caution: PNC-27 must not be positioned as an alternative to surgery, chemotherapy, radiation, immunotherapy, targeted therapy, or any evidence-based oncology care.
PNC-27 + Paclitaxel
Preclinical synergy
PNC-27PaclitaxelOvarian cancer
Ovarian-cancer work reported synergy and suggested PNC-27 may target cells surviving paclitaxel. Synergy between paclitaxel and PNC-27 was reported in ovarian-cancer models. This is preclinical/ex-vivo only — not a clinical regimen, and not evidence that the combination is safe or effective in patients.
Agent
Role
Grade
PNC-27
Membranolytic (proposed)
P
Paclitaxel
Approved cytotoxic
Preclinical combo: P
PNC-27 + Lithium Acetoacetate
Cell-line finding
PNC-27Lithium acetoacetateCervical cancer
A 2025 cervical-cancer study reported that lithium acetoacetate lowered PNC-27 IC₅₀ values in cervical-cancer cell lines. A ketone-body strategy enhanced PNC-27 potency in cervical-cancer cells. This is a single cell-line observation; lithium salts carry real clinical toxicity considerations and this is not a usable combination. Grade P.
Element
Finding
Grade
Lithium acetoacetate
↓ PNC-27 IC₅₀ (cell line)
P
Caution
Lithium toxicity considerations
—
PNC-27 + HDM-2/MDM-2 Profiling
Biomarker concept
PNC-27Membrane HDM-2
The mechanism suggests membrane HDM-2/MDM-2 expression might enrich for susceptibility. Tumor-cell membrane HDM-2 localization is the proposed selectivity basis. This is a research hypothesis for patient/sample stratification, not a clinically validated selection biomarker. Grade P.
Marker
Concept
Validated?
Membrane HDM-2
Susceptibility enrichment
No
TP53 status
Mechanistic context
No
PNC-27 + Standard Oncology Care
Trial-only concept
PNC-27Standard of care
Theoretically PNC-27 could be studied as an adjunctive cytotoxic strategy — but only inside a regulated trial, with unknown interactions and a real risk of delaying proven therapy. FDA warns that unproven cancer products can cause direct harm and indirect harm by delaying beneficial treatment. Grade D/P.
Condition
Requirement
Any human combination
Regulated clinical trial only
Standard care
Must not be replaced or delayed
Hard-constraint clinical note — PNC-27 should not be positioned as an alternative to surgery, chemotherapy, radiation, immunotherapy, targeted therapy, or evidence-based oncology care. The combinations above are preclinical research findings only. The FDA specifically warns that unproven cancer products can cause direct harm (contamination, toxicity) and indirect harm by delaying beneficial treatment. If you or someone you care about is facing cancer, the right next step is a licensed oncology team — not a peptide bought online.
05 · Safety, contamination & the FDA warning
The safety picture is dominated by what we don't know.
PNC-27's preclinical selectivity is encouraging in a dish, but there is no robust human safety dataset — and there are concrete, documented harms tied to real-world products: an FDA finding of bacterial contamination, a case report of massive GI hemorrhage, and the broader danger of patients delaying proven cancer treatment. The honest summary is that the risks are largely unstudied and the regulatory verdict is a warning.
Reported safety signals & evidence gaps
FDA contamination findingAn FDA lab found Variovorax paradoxus bacteria in a marketed inhalable PNC-27 sample — potentially life-threatening infection risk. Grade D.
Treatment-delay harmSubstituting an unproven product for proven oncology care is a central, documented danger. Grade D.
Massive GI hemorrhage (case report)A case report associates massive GI hemorrhage with experimental PNC-27 therapy — causality cannot be inferred from one report, but it is a flag. Grade D.
No human safety datasetNo adequate human safety/PK data located — immunogenicity, infusion risk, organ toxicity, and reproductive safety are unstudied. Grade D/P.
Preclinical selectivitySelective killing of cancer cells with relative sparing of normal cells in preclinical models — promising in vitro, not a human safety proof. Grade P/C.
Unverified product potencyOnline products have unknown potency, sterility, and identity — the FInding above shows real contamination has occurred.
Practical safety framework
If you have cancer
Work with a licensed oncology team. Do not substitute or delay proven treatment (surgery, chemotherapy, radiation, immunotherapy, targeted therapy) for an unapproved peptide. Ask your team about legitimate clinical trials if you want investigational options.
If a product is being marketed to you
Be skeptical of any product claiming to "cure all cancers." The FDA warns specifically about PNC-27 cancer-cure marketing and found bacterial contamination in a sample. Online sourcing means unknown sterility, potency, and identity.
If exposure has occurred
Contact a healthcare provider, especially if immunocompromised or experiencing fever, infection signs, bleeding, or other symptoms. Serious adverse events from suspicious products can be reported to FDA MedWatch.
Contraindications & high-risk scenarios
Scenario
Concern
Severity
Active cancer outside oncology supervision
Risk of delaying proven treatment
High
Online "cancer cure" product
Fraud / contamination / unknown potency
High
Immunocompromised patient
Infection risk from contaminated product
High
Pregnancy / breastfeeding
No reproductive safety data
High
Pediatric use
No safety / PK data; vulnerable to infection
High
Severe liver or kidney disease
Unknown metabolism / clearance
High
Concurrent chemo / immunotherapy
Unknown interaction
High
Inhaled / nebulized use
Pulmonary contamination / infection risk
High
Anticoagulation / bleeding disorder
Unknown bleeding risk; case-report concern
Moderate–High
Athlete subject to testing
WADA S0 non-approved substance
High
Elderly patients
Heightened infection vulnerability
High
Any self-administration
No validated dose, route, or sterility
Avoid
06 · Evidence base
What the evidence actually shows.
PNC-27 has a coherent, repeatedly studied preclinical mechanism — membrane HDM-2/MDM-2 targeting and cancer-cell lysis — supported across modeling, cell-line, ex-vivo primary-tumor, and animal work by the originating group and collaborators. What it does not have is human clinical-trial evidence: no validated efficacy, no validated dose, no approved route. The overall verdict is very low evidence strength for clinical use, with moderate preclinical mechanistic interest.
Human trials
None
No robust human clinical trials located; no approved dosing, no validated human efficacy. Investigational / unapproved.
The defining mechanistic paper: a 32-residue peptide with an HDM-2-binding domain and CPP leader kills cancer (not normal) cells by binding membrane HDM-2 and forming pores; modeling supports 1:1 PNC-27–HDM-2 complexes with the leader pointing away, and immuno-EM localizes the peptide to membrane HDM-2.
Sarafraz-Yazdi et al. 2010 — HDM-2-binding conformation & membrane killing
PNAS study showing PNC-27 adopts an HDM-2-binding conformation and kills cancer cells via membrane HDM-2; found significant membrane HDM-2 in cancer but not normal lines, and made resistant normal cells susceptible by forcing surface HDM-2 expression — the core selectivity evidence.
Sookraj et al. 2010 — PNC-27 acts as the intact peptide
Demonstrated that PNC-27 induces tumor-cell lysis as the intact peptide rather than through cleavage fragments — consistent with a structural membrane-lytic mechanism rather than an intracellular signaling cascade.
Davitt et al. 2014 — leukemia killing tied to membrane HDM-2
In a poorly differentiated non-solid human leukemia line, PNC-27-induced necrosis depended on plasma-membrane HDM-2 expression — extending the membrane-HDM-2 selectivity model to hematologic malignancy.
Krzesaj et al. 2024 — unique mechanisms incl. mitochondrial disruption
Pancreatic-cancer mechanistic work proposing that PNC-27 causes pore formation plus intracellular entry and mitochondrial-membrane disruption — the emerging dual-mechanism hypothesis beyond pure surface lysis.
Miller / Krzesaj et al. 2025 — kills cervical cancer but not normal cervical cells
Reported PNC-27 killing of cervical-cancer cell lines but not normal cervical cells, with lithium acetoacetate enhancing the effect (lower IC₅₀) — a recent selectivity + combination cell-line finding.
Alagkiozidis et al. 2017 — PNC-27 + paclitaxel synergy
Reported synergy between paclitaxel and PNC-27 in ovarian-cancer models, suggesting PNC-27 may act on cells surviving taxane therapy — a preclinical combination signal, not a clinical regimen.
PNC-28 — penetratin sequence causes necrosis in pancreatic cancer
The sibling peptide PNC-28 (p53 17–26 + penetratin) caused tumor-cell necrosis rather than apoptosis in human pancreatic-cancer cells, and the penetratin sequence was required — supporting the shared membrane-lytic mechanism of the PNC series.
Wang et al. 2020 — targeting cell-membrane HDM2 in AML
A Leukemia paper framing membrane HDM2 as a therapeutic target in acute myeloid leukemia — the mechanistic foundation for the AML work and the membrane-localization selectivity hypothesis.
ASH 2017 abstract — PNC-27 targeting plasma-membrane HDM2 in AML
Conference abstract reporting PNC-27 activity in AML mouse/human models, including a 40 mg/kg/day mouse regimen for two weeks — an animal efficacy signal that is explicitly not human-translatable.
2024 review — peptide-induced "poptosis" / selective cancer killing
A review framing the broader class of membrane-active anticancer peptides that kill cancer cells while sparing normal cells, situating PNC-27's necrosis mechanism within the wider field. peptide-induced selective killing review.
FDA 2017 — do not use PNC-27 products for cancer treatment
FDA consumer warning: PNC-27 is not approved for any disease, was marketed online as a cancer cure (nebulized/IV/suppository forms), and an FDA lab found Variovorax paradoxus contamination in an inhalable sample. Patients should discuss approved options with their providers.
Experimental PNC-27 therapy & massive GI hemorrhage
A gastroenterology case report describing massive GI hemorrhage in the setting of experimental PNC-27 therapy. A single report cannot establish causality, but it underscores the unknown human safety profile.
GRADE summary — Overall evidence strength is very low for clinical use and moderate for preclinical mechanistic interest. PNC-27 has a coherent, repeatedly supported preclinical mechanism centered on membrane HDM-2/MDM-2 targeting and cancer-cell lysis, with consistent in-vitro selectivity and animal efficacy signals. But there is no adequate human efficacy or safety evidence, no validated dosing, no approved route, and active FDA safety/regulatory warnings around marketed products. Honest positioning: "a mechanistically interesting research-only anticancer peptide candidate — not a clinician-ready therapeutic, and explicitly not a product to buy or self-administer."
07 · Compare & contrast
PNC-27 vs the p53 / MDM2 field.
PNC-27 sits in a small family of p53-derived peptides that act at the membrane via necrosis, distinct from the larger effort to drug the intracellular MDM2-p53 interaction for apoptosis. Its closest sibling is PNC-28; the azurin-derived p28 takes a p53-stabilization approach; and the Nutlin-class small molecules are the most clinically advanced MDM2-p53 strategy — but none of these is interchangeable with PNC-27.
L1 · Consumer — PNC-27 is an experimental peptide studied for its ability to attach to cancer-cell membranes and cause rapid cancer-cell breakdown in lab models. It is not an approved cancer treatment, there is no safe consumer dosing protocol, and the FDA has warned against products sold as a PNC-27 cancer cure — including a finding of bacterial contamination. If you are facing cancer, the safest and most effective path is a licensed oncology team.
L2 · Clinical — PNC-27 is a p53-derived, HDM-2/MDM-2-targeting chimeric peptide with preclinical evidence for selective tumor-cell membrane lysis across several cancer models. The clinical evidence base is insufficient: no established human PK, no approved indication, no validated dose, and active FDA warnings for unapproved marketed products plus a documented contamination finding and a GI-hemorrhage case report. It belongs in research and regulated trials, not in practice.
L3 · Research — PNC-27 fuses a p53 12–26 HDM-2-binding motif to a penetratin-like membrane-residency sequence. The leading model: binding to cancer-cell membrane HDM-2/MDM-2, assembly of 1:1 peptide–HDM-2 complexes into pore-like structures, membrane-permeability collapse, necrotic lysis, and a proposed secondary mitochondrial-disruption branch. Selectivity is attributed to aberrant tumor-cell membrane HDM-2 localization. The mechanism is coherent and repeatedly supported preclinically; translational validation in humans does not exist.
08 · References & evidence
Source register.
Evidence grades reflect the strength of support for the specific claim cited, not the prestige of the journal. For PNC-27, the firmest sources establish the molecular mechanism and the regulatory/safety reality — almost everything else is preclinical (Grade P). There are no Grade-A or robust human-trial sources, which is itself the most important fact on the page.