Atlas/ Immune & Wound Biology/ Host-Defense Peptides/ LL-37 / Cathelicidin
Reading depth · audience layer
Class 12 · Immune & wound biology · host-defense / antimicrobial peptide · hCAP18 / CAMP · research-only · human dosing blocked

LL-37Cathelicidin · the only human host-defense peptide — a wound-research lane, not an immune protocol

LL-37 is a natural immune peptide the human body makes itself to defend skin and mucosal surfaces against microbes and to help repair wounds. It is the only human cathelicidin antimicrobial peptide. Its most credible human research is in topical wound care — venous leg ulcers and diabetic foot ulcers. It is not a general "immune booster," and Intrasigna blocks all injectable, systemic, oral, intranasal, and personalized-dosing output for it.

LL-37 is a pleiotropic host-defense peptide with antimicrobial, antibiofilm, chemotactic, endotoxin-neutralizing, angiogenic, epithelial-repair, and immunomodulatory effects whose biology is highly context-dependent. Topical LL-37 was safe with dose-response healing in a 2014 venous-leg-ulcer RCT, though a larger phase-IIb trial (HEAL, n=148) found no significant full-cohort difference, with a possible large-ulcer subgroup signal. In inflammatory skin disease it can act as an autoantigen/immune amplifier (psoriasis, lupus) — so the page is research-only and hard-gated.

LL-37 (sequence [LL-37, 37 aa]) is a 37-residue cationic (+6), amphipathic, cysteine-free α-helix released from the hCAP18 precursor (gene CAMP, chr 3p21.3) by proteinase 3. It disrupts microbial membranes via cationic/amphipathic interactions, engages FPR2/FPRL1 chemotaxis, neutralizes LPS, drives keratinocyte migration via EGFR transactivation, and forms immunostimulatory complexes with self-DNA/RNA that activate pDCs via TLR9 → type-I interferon — beneficial in defense and repair, but pro-inflammatory and tumor-context-dependent elsewhere.

37 aa Cationic +6 · amphipathic α-helix
hCAP18 / CAMP Only human cathelicidin
topical Strongest human lane (wounds)
BLOCKED Human dosing output
Status
Research-only · topical trial-arm display only · injectable/systemic blocked
Open trial-arm reference engine
Source
hCAP18 precursor · proteinase-3 cleaved
Best lane
Topical chronic-wound research (VLU, DFU)
Risk lanes
Psoriasis/lupus · cancer-context · cytotoxicity
RESEARCH-ONLY · human dosing output is BLOCKED LL-37 is an endogenous human host-defense peptide whose strongest human research is topical wound care. Intrasigna blocks public injectable, systemic, intranasal, oral, and personalized-dosing output because immune activation, autoimmune signaling, cancer-context uncertainty, cytotoxicity, and formulation stability remain unresolved. Only source-backed topical clinical-trial arms are displayed, as research context — never a treatment recommendation.
01 · At a glance

A rich mechanism, hard-gated.

LL-37 is one of the most biologically interesting peptides in this atlas and one of the most tightly gated. Its wound-repair and antimicrobial biology is genuinely compelling and human-tested topically, but the same immune potency that helps in defense can amplify autoimmune and inflammatory disease — and its cancer biology cuts both ways. Intrasigna therefore publishes it as an advanced-research / immune & wound-biology page with a topical trial-arm reference engine, not a dosing protocol.

🧬
Identity
Only human cathelicidin
A 37-aa peptide cleaved from hCAP18 (gene CAMP) — the sole human cathelicidin. Grade A/B.
🦠
Antimicrobial
Membrane disruption
Cationic/amphipathic disruption of microbial membranes; broad-spectrum + antibiofilm. Grade B.
🩹
Wound repair
Re-epithelialization
Promotes keratinocyte migration; deficient in chronic ulcer epithelium. Grade B.
🧪
Human lane
Topical wounds
VLU and DFU topical trials — the only source-backed human dosing context. Grade B/C.
Human dosing
Blocked
Injectable, systemic, oral, intranasal, and protocol output are blocked. Admin rule.
🔥
Risk lane
Autoimmunity
Self-nucleic-acid complexes drive pDC/TLR9/IFN — psoriasis & lupus amplification. Risk.
⚖️
Cancer biology
Context-dependent
Pro-tumor in some tissues, suppressive in others — never an anti-cancer claim. Risk.
🛠️
Development limit
Cytotoxic / unstable
Eukaryotic cytotoxicity and proteolytic instability constrain therapeutic use. Grade C.
02 · Mechanism of action

One peptide, a whole defense program.

LL-37 is a paradigm "pleiotropic" host-defense peptide: a single small α-helix that kills microbes, breaks biofilms, recruits and tunes immune cells, neutralizes endotoxin, drives wound repair and new blood vessels — and, in the wrong context, amplifies sterile inflammation and autoimmunity. The same cationic, amphipathic chemistry that disrupts microbial membranes is what makes its biology so context-dependent.

Grade B
🦠

1 · Direct antimicrobial membrane disruption

Its positive charge pulls it onto microbial membranes, which it then permeabilizes.
Clinical significance: The cationic, amphipathic helix binds anionic microbial membranes and disrupts them, killing a broad range of Gram-positive and Gram-negative bacteria, including some antibiotic-resistant strains. It also contributes to respiratory, oral-cavity, and antimycobacterial defense at epithelial surfaces.
Molecular detail: Killing is described by carpet/toroidal-pore models — the helix's hydrophobic face inserts into the lipid bilayer while cationic residues anchor anionic head-groups, causing permeabilization. LL-37 is found in neutrophils, epithelia, sweat, saliva, wound fluid, and seminal plasma.
Grade B/C
🧫

2 · Antibiofilm activity

It can prevent and disrupt the protective biofilms bacteria build on wounds and surfaces.
Clinical significance: LL-37 shows strong preclinical antibiofilm activity — relevant to chronic wounds — though clinical antibacterial effect was inconsistent in the diabetic-foot-ulcer trial.
Molecular detail: LL-37 interferes with biofilm attachment, quorum-sensing signaling, and extracellular matrix integrity at sub-bactericidal concentrations; formulation and stability limit translation to durable wound-surface effect.
Grade B
🩹

3 · Keratinocyte migration & re-epithelialization

It signals skin cells to migrate and close wounds — and is missing where ulcers won't heal.
Clinical significance: LL-37 promotes keratinocyte migration and re-epithelialization of human skin wounds and is deficient in chronic ulcer epithelium — the core rationale for the wound-research lane.
Molecular detail: Migration is linked to EGFR transactivation and downstream ERK signaling; maximal keratinocyte migration was reported around 1 µg/mL in a Boyden-chamber assay — strictly in-vitro mechanistic context, not a human dose.
Grade B
🩸

4 · Angiogenesis & endothelial activation

It helps grow the new blood vessels that feed healing tissue.
Clinical significance: LL-37 activates endothelial cells and promotes neovascularization in experimental models, supporting granulation-tissue formation in wounds.
Molecular detail: Pro-angiogenic effects involve FPR2-dependent endothelial activation and VEGF/PI3K–AKT signaling; topical synthetic/recombinant LL-37 increased vascularization and re-epithelialization in preclinical wound models.
Grade C
🧭

5 · Chemotaxis & LPS neutralization

It calls in immune cells and can mop up bacterial endotoxin.
Clinical significance: LL-37 recruits immune cells via FPR2/FPRL1 chemotaxis and binds and neutralizes LPS/endotoxin — bridging innate and adaptive immunity. This is mechanistic, not a sepsis-therapy claim.
Molecular detail: As an "alarmin," LL-37 chemoattracts neutrophils, monocytes, and T cells; it is a component of neutrophil extracellular traps (NETs) and modulates TLR responses to microbial ligands.
Grade C · Risk
🔥

6 · Nucleic-acid immune amplification (risk)

Bound to the body's own DNA/RNA, it can switch on sterile inflammation and autoimmunity.
Clinical significance: LL-37 complexes with self-DNA/RNA and lets plasmacytoid dendritic cells recognize them via TLR9/TLR7, driving type-I interferon — a central mechanism in psoriasis and a major safety flag.
Molecular detail: In lupus, NET-derived DNA–LL-37 complexes and anti-LL-37 antibodies amplify pDC activation and type-I IFN; LL-37 also presents RNA to scavenger receptors (e.g., SR-B1) on keratinocytes, forming ordered supramolecular complexes that potentiate sensing.
L3 · Dual-edged cascade
From host-defense peptide to context-dependent outcome
🧬 LL-37
hCAP18 · proteinase 3
🦠 Defense
microbial · LPS · chemotaxis
🩹 Repair
re-epithelialization · vessels
🔥 Inflammation
pDC · TLR9 · IFN
⚖️ Context outcome
benefit or harm
L2 · Mechanism map
Mechanism clusters & protocol relevance
ClusterActionRelevance / grade
AntimicrobialMembrane disruption, antibiofilmWound-infection lane · B
Epithelial repairKeratinocyte migration (EGFR/ERK)Chronic-wound lane · B
AngiogenesisEndothelial activation, VEGF/PI3K–AKTGranulation/perfusion · B
Immune recruitmentFPR2 chemotaxis, NET componentInflammation monitoring · C
Endotoxin bindingLPS neutralizationMechanistic only · C
Nucleic-acid sensingpDC/TLR9 → type-I IFNAutoimmune risk flag · C
L3 · receptor & signaling partners
Reported interaction systems
PartnerEffectContext
FPR2 / FPRL1Chemotaxis, endothelial activationImmune recruitment, angiogenesis
EGFR / ErbBTransactivation → migrationKeratinocyte re-epithelialization
TLR9 / TLR7 (via pDC)Self-nucleic-acid sensingPsoriasis / lupus risk
Scavenger receptor (SR-B1)RNA presentationKeratinocyte IFN response
P2X7 / inflammasomeInflammatory signalingContext-dependent
LPS (direct binding)Endotoxin neutralizationAnti-endotoxic (mechanistic)
03 · Protocol engine & research lanes

A route-gated research engine — not a dosing protocol.

LL-37 is not a "blocked" page — it is a structured topical wound-research engine with hard gates. The panels below are the engine's lanes: the venous-leg-ulcer and diabetic-foot-ulcer human trial arms (displayed as research context only), the antimicrobial/biofilm mechanistic lane, the eligibility & safety gate logic, and the explicitly blocked routes. The engine displays trial concentrations, schedules, durations, and endpoints with citations — it never generates a personalized dose, an injectable dose, a cycle, or reconstitution math.

Engine mode · trial-only topical research The calculator is a topical trial-arm reference, gated by route, wound type, infection severity, vascular status, autoimmune and cancer history, and provider/IRB review. Topical VLU/DFU arms display as research context; injectable, systemic, oral, intranasal, and "immune protocol" routes all return BLOCKED.
Evidence honesty The engine deliberately shows mixed efficacy. A 2014 RCT found topical LL-37 safe with dose-response healing in hard-to-heal VLUs, but the larger HEAL phase-IIb trial (n=148) found no significant full-cohort difference, with only a possible large-ulcer subgroup signal. The DFU RCT improved granulation but did not reduce cytokines or bacterial colonization.
Lane A — Venous leg ulcer research
Topical · 0.5 & 1.6 mg/mL · twice weekly · 4 weeks
Grade B
Research status
Human topical trial lane — trial-arm display only, not a treatment protocol.
Trial arms
Topical LL-37 0.5 mg/mL and 1.6 mg/mL, twice weekly for 4 weeks, alongside compression.
2014 RCT
Reported safe with dose-response healing in hard-to-heal VLUs.
HEAL phase IIb
n=148; no significant full-cohort difference, with a possible large-ulcer subgroup signal — mixed efficacy.
Standard care
Compression therapy remained central; LL-37 was studied as an adjunct.
Endpoints
Wound-area reduction, complete healing, time-to-healing, tolerability.
Display as clinical-trial context only. Block if uncontrolled infection, poor perfusion, autoimmune flare, or malignancy concern.
VLU · trial arms
Source-backed concentrations
ArmScheduleBasis
0.5 mg/mL2×/week · 4 wkRCT arm
1.6 mg/mL2×/week · 4 wkRCT arm
Full cohort (HEAL IIb)NS; subgroup signal
Lane B — Diabetic foot ulcer research
Topical cream · 0.5 mg/g · twice weekly · 4 weeks
Grade B/C
Research status
Human topical trial lane (RCT) — trial-arm display only.
Concentration
LL-37 cream 0.5 mg/g, twice weekly for 4 weeks.
Population
Diabetic foot ulcer with mild infection (trial context).
Primary signal
Improved granulation index across days 7, 14, 21, 28 and healing rate.
Negative findings
No significant reduction in IL-1α, TNF-α, or aerobic bacterial colonization.
Tolerability
No side effect directly attributed to LL-37 cream; one mild irritant dermatitis tied to wound exudate.
Requires diabetes control, vascular status (ABI), infection-severity assessment, and wound-care supervision. Block in severe/deep infection or osteomyelitis.
DFU · trial arm & endpoints
Source-backed cream protocol
FieldValueSource
Concentration0.5 mg/g creamRCT
ScheduleTwice weekly · 4 wkRCT
Primary endpointGranulation indexRCT
Inclusion (perfusion)ABI 0.9–1.3Trial criterion
Lane C — Antimicrobial / biofilm research
Mechanistic / preclinical
Grade C
Research status
Preclinical/mechanistic — mostly topical/local models; no broad human infection-treatment protocol.
Spectrum
Antimicrobial activity against Gram-positive and Gram-negative pathogens, including resistant strains.
Biofilm
Antibiofilm activity at sub-bactericidal concentrations in preclinical models.
MRSA
Mouse wound-infection model evidence only — not a human protocol; no human dose conversion.
In-vitro context
Peak keratinocyte migration ≈ 1 µg/mL in Boyden-chamber assay — mechanistic only.
Antimicrobial/biofilm activity does NOT create a human infection-treatment protocol. Output is mechanism summary only unless tied to a wound-trial context.
Preclinical · status
Model-to-human gating
ModelStatusHuman conversion
In-vitro antimicrobialMechanisticNone
Biofilm assaysPreclinicalNone
MRSA mouse woundAnimalBlocked
Eligibility & safety gate logic
Engine decision tree
Admin
Route gate
Injectable/systemic/oral/intranasal → BLOCK (no source-backed human systemic dosing basis).
Indication gate
General immunity / anti-aging / wellness → BLOCK (no clinical protocol basis).
Wound-type gate
Topical + VLU or DFU → allow trial-arm display only.
Autoimmune / cancer gate
Psoriasis, lupus/SLE, active autoimmune flare, or active cancer → block or provider-review-only.
Infection-severity gate
Systemic/deep infection, osteomyelitis, severe cellulitis → block; requires standard care, not a substitute for antibiotics/debridement.
Vascular gate
Poor perfusion / abnormal ABI / critical limb ischemia → block; vascular assessment required.
Final output shows trial concentration, frequency, duration, endpoints, exclusions, and citations — never personalized/injectable dosing, cycles, or reconstitution.
Engine · decision tree
Gate sequence
StepGateAction
1RouteBlock non-topical
2IndicationBlock wellness/immune
3Wound typeAllow VLU/DFU display
4Autoimmune/cancerBlock / provider review
5Infection severityBlock severe/deep
6VascularBlock poor perfusion
7OutputTrial-arm display only
Blocked routes & outputs
No human dosing basis
Grade E · blocked
Injectable / systemic
Blocked — no approved or source-backed human systemic dosing basis.
Intranasal / oral
Blocked — peptide degradation and no dosing basis; mechanistic claims only.
"Immune protocol"
Blocked — no protocol output; LL-37 is not a general immune booster.
Cancer / autoimmune protocol
Blocked — context-dependent biology; not a therapy claim.
Reconstitution / mixing
Blocked — no preparation guidance without a pharmacy/clinical formulation source.
Why: eukaryotic cytotoxicity and proteolytic instability/formulation challenges limit therapeutic development; systemic safety is unresolved.
Route · status table
Output rules by route
RouteStatusOutput
Topical wound (VLU/DFU)Trial-onlyStudy arm + citation
Injectable / systemicBlockedNo human dose
Intranasal / oralBlockedNo human dose
"Immune protocol"BlockedNo protocol
Animal modelResearch-onlyNo human conversion
L2 · Topical trial-arm reference · human output blocked

Trial-Arm Reference Engine

LL-37 is an investigational host-defense peptide with immune-activating and tissue-context-dependent effects. Public dosing, injectable protocols, and personalized treatment output are blocked. Only source-backed topical clinical-trial arms may be shown for educational review. Selecting any non-topical route returns BLOCKED. This is research context, not a treatment recommendation.

Trial concentration
Frequency
Duration
Model
Basis
04 · Combinations & interaction logic

Bidirectional immune effects — no public stacks.

LL-37 has bidirectional immune effects, so Intrasigna publishes no public stack recommendations for it. It should not be auto-combined with immune peptides, wound peptides, antimicrobials, or metabolic peptides without a safety note and provider review — especially in autoimmune, inflammatory-skin, cancer, or infected-wound contexts.

+ BPC-157 / TB-500
Blocked / research-only
LL-37 BPC-157 TB-500
A popular "wound-repair stack" idea — but there is no source-backed combination safety data. Blocked / research-only; do not present as validated synergy. Grade E.
ElementStatusReason
BPC-157 / TB-500BlockNo combo safety source
+ Antibiotics
Provider-only
LL-37 Antibiotics
LL-37 does not replace antibiotics or debridement. Any adjunct research context is provider-only; standard infection care takes precedence. Grade C.
ElementRoleGate
AntibioticsStandard careProvider-only
+ GHK-Cu (topical)
Research-only
LL-37 GHK-Cu
Both appear in wound/cosmetic discussion, but combined wound-healing synergy is not source-backed. Avoid overstating; research-only. Grade C.
ElementStatusNote
GHK-CuResearch-onlyNo synergy claim
+ Steroids / Immunosuppressants
Provider-only
LL-37 Immunosuppressants
LL-37's immune-activating effects can conflict with immunosuppressive therapy; clinical context is required. Provider-only. Grade C.
ElementConcernGate
Steroids / ISConflicting immune effectsProvider-only
+ Vitamin D
Research / observational
LL-37 Vitamin D
Vitamin D (via VDR) directly induces CAMP/LL-37 expression, and serum LL-37 has correlated with VLU healing — but adequate vitamin D status is not a dosing substitute or protocol. Grade C.
ElementRelationshipGate
Vitamin DInduces CAMP expressionNot a dose substitute
+ Anti-inflammatory peptides
Blocked
LL-37 Anti-inflammatory peptides
Risk of contradictory immune effects; combining is blocked without clinical review given LL-37's pro-inflammatory potential in some contexts. Grade E.
ElementStatusReason
Anti-inflammatory peptidesBlockContradictory effects
+ Other GLP-1 / metabolic peptides
Blocked / no basis
LL-37 Metabolic peptides
No source-backed rationale to combine LL-37 with metabolic peptides; blocked as an unsupported stack. Grade E.
ElementStatusReason
Metabolic peptidesBlockNo basis
General "immune-boost" stacking
Blocked
LL-37 Immune protocol
LL-37 is not a casual immune booster; general immune-stacking protocols are blocked. Its immune effects are bidirectional and context-dependent. Grade E.
UseStatusReason
Immune-boost stackBlockNo protocol basis
Stack warning — LL-37 has bidirectional immune effects. Do not combine it with immune-active peptides or antimicrobial protocols without clinical review, especially in autoimmune, inflammatory-skin, cancer, or infected-wound contexts.
05 · Safety & contraindications

One of the atlas's strongest safety gates.

LL-37 needs aggressive safety gating because the very potency that makes it useful in defense and repair can push immune activation in harmful directions. The dominant concerns are autoimmune/inflammatory amplification (psoriasis, lupus), context-dependent cancer biology, eukaryotic cytotoxicity, and the fact that topical wound research never replaces standard infection or vascular care.

⛔ Research-only — LL-37 can act as an autoantigen/immune amplifier in psoriasis and lupus-type pathways and has tissue-specific, contradictory cancer biology. Human dosing output is blocked; only topical clinical-trial arms are shown as research context. Provider review is required for any clinical-research use.
Core safety risks
Autoimmune activationSelf-DNA/RNA complexes drive pDC/TLR9 type-I IFN — high concern.
Psoriasis worseningActs as autoantigen/immune amplifier; LL-37-specific T cells track disease activity.
Lupus / SLE signalingNET-derived DNA–LL-37 complexes + anti-LL-37 antibodies amplify innate immunity.
Cancer-context uncertaintyPro- and anti-tumor reports depending on tissue/pathway.
CytotoxicityCytotoxic to eukaryotic cells — a known development limitation.
Histamine / mast-cellMay influence histamine/inflammatory pathways — flushing, itch, skin reactions.
ThromboinflammationCathelicidin biology reviewed in thrombosis/thromboinflammatory disorders.
Local irritation / dermatitisPossible wound-environment irritation; monitor skin response.
Proteolytic instabilityDegradation limits wound persistence and drug development.
Inconsistent antibacterial effectDFU trial showed no significant bacterial-colonization reduction.
Cardiometabolic inflammation contextExcess LL-37 in inflammatory skin disease has been linked to altered lipid biology.
Not an antibiotic replacementSevere/deep infection and osteomyelitis require standard care.

Evidence-grade summary

Evidence · by bucket
How strong is each claim class
Evidence bucketGradeConfidence
Endogenous biology / identityA/BHigh (~90)
Antimicrobial mechanismB~80
Antibiofilm mechanismB/C~70
Human wound biology / re-epithelializationB~75
Topical VLU clinical researchB~70 (mixed by trial)
Topical DFU clinical researchB/C~65
Injectable / systemic human useE · blocked~5
General immune boostingE · blocked~5
Autoimmune benefit claimsD · risk~10
Cancer therapy claimsD/E · risk~10

Dose-basis records (engine source cards)

Dose-basis · trial-only
What the engine may display vs block
BasisArmHuman output
Clinical trial (VLU)0.5 & 1.6 mg/mL, 2×/wk, 4 wkfalse (display only)
Clinical trial (DFU)Cream 0.5 mg/g, 2×/wk, 4 wkfalse (display only)
Injectable / systemicNo basisfalse · blocked
Animal model (MRSA)Mouse woundfalse · no conversion
Autoimmune / cancer protocolNot supportedfalse · blocked

Eligibility & biomarker engine

Biomarkers · wound-research eligibility
Baseline context the engine requires
Category / markerPurposeGate
Wound type (VLU/DFU/etc.)Determines trial-lane relevanceSelection
Wound size / duration / depthChronicity, endpoint baselineSelection
Infection severity + wound cultureBlocks severe/deep infectionSafety gate
ABI / perfusionBlocks poor perfusion (DFU inclusion ABI 0.9–1.3)Safety gate
HbA1c / fasting glucoseRequired for DFU laneContext
CRP / ESRSystemic inflammatory burdenMonitor
CBC with differentialInfection / immune statusBaseline
ANA / anti-dsDNAAutoimmune/lupus screen if indicatedSafety gate
Autoimmune / psoriasis historyExclusion logicSafety gate
Cancer historyExclusion / oncology reviewSafety gate
IL-1α / TNF-α / IL-6 (research)Wound-fluid inflammatory markersResearch endpoint

Monitoring endpoints

Wound-healing endpoints

Wound-area reduction (objective measurement), granulation index (key DFU outcome), re-epithelialization percentage, drainage/exudate, and pain score for tolerability — tracked across the study window.

Safety / infection

Signs of infection (redness, warmth, drainage, odor, fever), CRP/ESR if systemic concern, and local dermatologic reaction (itching, rash, dermatitis). Escalate to standard care if infection worsens.

Immune-safety surveillance

Watch for autoimmune-flare signals (new rash, worsening plaques, joint pain, photosensitivity, oral ulcers), especially given the psoriasis/lupus risk lane. Provider/IRB review for any clinical-research use.

Contraindications & hard exclusion flags

ConditionConcernSeverity · grade
Injectable / systemic / oral / intranasal useNo source-backed human dosing basisBlocked
General immune / wellness protocolNo clinical protocol basisBlocked
Active psoriasisAmplifies psoriatic immune pathwaysBlock / review
Lupus / SLE / autoimmune diseaseNucleic-acid immune activationBlock / review
Active autoimmune flareImmune-activation riskBlock
Active malignancy / cancer historyTissue-specific, contradictory biologyBlock / oncology review
Systemic infection / sepsisNot an antimicrobial replacementBlock
Deep infected ulcer / osteomyelitisRequires antibiotics/debridement/imagingBlock protocol
Critical limb ischemia / poor perfusionPerfusion must be addressed firstBlock protocol
Uncontrolled inflammatory skin diseaseImmune activation / irritationCaution / review
Severe allergy / mast-cell disorderHistamine/mediator concernHigh-risk warning
Pregnancy / breastfeedingNo adequate safety basisBlock
Pediatric useNo broad dosing/safety basisBlock
Uncontrolled diabetes (DFU lane)Healing / infection riskOptimize first
Mixing / reconstitution requestNo formulation sourceBlocked
Animal-model → human conversionNot permittedBlocked
Non-research / non-provider settingProvider/IRB review requiredReview required
"Loading" / cycle protocol requestNo such research conceptBlocked
Combination with immune-active peptidesContradictory immune effectsBlock / review
Thromboinflammatory disorder historyCathelicidin thrombosis biologyCaution
GRADE summary — LL-37's endogenous biology and antimicrobial/wound mechanisms are well supported (identity A/B; antimicrobial and wound-repair mechanisms B), and topical human wound research is real but mixed (VLU/DFU B–C, with the HEAL phase-IIb trial tempering the earlier positive RCT). Systemic, injectable, immune-boost, autoimmune, and cancer claims are unsupported (D/E) and blocked. The decisive levers are route gating (topical-only), wound-type and vascular/infection eligibility, autoimmune and cancer exclusion, and provider/IRB review — with human dosing output blocked and only source-backed topical trial arms displayed as research context.
06 · Trials & evidence base

Real human data — topical, and mixed.

LL-37's human evidence lives almost entirely in topical chronic-wound trials. An early randomized VLU study was positive on safety and dose-response; a larger phase-IIb VLU trial was not significant in the full cohort; a DFU RCT improved granulation but not cytokines or bacterial colonization. Presenting all three honestly — including the negatives — is what makes the page credible rather than promotional.

VLU · 2014 RCT
safe · dose-response
Topical LL-37 (0.5/1.6 mg/mL) enhanced healing in hard-to-heal VLUs. Grönberg 2014.
VLU · HEAL IIb
n=148 · NS
No significant full-cohort difference; possible large-ulcer subgroup signal. Mahlapuu 2021.
DFU · RCT
granulation ↑
Cream 0.5 mg/g improved granulation; no cytokine/bacterial reduction. DFU RCT.
Mechanistic
re-epithelialization
Human wound biology + EGFR-driven keratinocyte migration. Wound studies.
BHuman · VLU RCT

Topical LL-37 in hard-to-heal venous leg ulcers (2014)

A randomized, placebo-controlled trial found topical LL-37 safe and showed dose–response efficacy in hard-to-heal venous leg ulcers, testing concentrations including 0.5 and 1.6 mg/mL twice weekly for 4 weeks alongside compression — the strongest early human dosing-basis source.

B/CHuman · phase IIb

HEAL LL-37 — phase IIb VLU trial

A double-blind, randomized, placebo-controlled phase-IIb trial in 148 patients with hard-to-heal VLUs (LL-37 + compression) found no significant difference in the full cohort, with a possible benefit signal in a large-ulcer subgroup and no safety concerns — the result that keeps the page from overstating efficacy.

B/CHuman · DFU RCT

LL-37 cream in diabetic foot ulcers

A randomized, double-blind controlled trial of LL-37 cream (0.5 mg/g, twice weekly, 4 weeks) improved the granulation index across days 7–28, but did not significantly reduce IL-1α, TNF-α, or aerobic bacterial colonization; tolerability was good.

A/BIdentity · biology

The only human cathelicidin (hCAP18 / CAMP)

LL-37 is the sole human cathelicidin, a 37-residue cationic amphipathic α-helix released from the hCAP18 precursor; the CAMP gene sits on chromosome 3p21.3 and the active peptide is cleaved by proteinase 3 from residues 134–170.

BMechanism · wound repair

Re-epithelialization & EGFR transactivation

LL-37 promotes keratinocyte migration via EGFR transactivation and re-epithelialization of human skin wounds, and is reportedly deficient in chronic ulcer epithelium — the mechanistic basis for the wound lane.

C · RiskSafety · psoriasis

LL-37, self-DNA & psoriasis (Lande)

LL-37 complexes with self-DNA/RNA and enables plasmacytoid dendritic cells to recognize them via TLR9, driving type-I interferon — a central mechanism in psoriasis, with LL-37-specific T cells correlating with disease activity. This is the page's primary risk lane.

C · RiskSafety · lupus

NETs, DNA–LL-37 complexes & lupus

In SLE, neutrophil-extracellular-trap-derived DNA–LL-37 complexes and circulating anti-LL-37/anti-DNA antibodies activate pDCs via TLR9, enhancing type-I interferon — implicating cathelicidin in lupus-like innate-immune activation.

BRegulation · vitamin D

Vitamin D induces CAMP / LL-37

Active vitamin D directly induces the CAMP gene encoding LL-37 via a vitamin-D-response element, and serum LL-37 (not 25-OH-vitamin-D) correlated with venous-leg-ulcer healing in a small study — a regulatory relationship, not a dosing substitute.

CDevelopment · limits & analogs

Cytotoxicity, instability & derived analogs

Eukaryotic cytotoxicity and proteolytic instability, formulation challenges, and production cost limit LL-37's therapeutic development, which is why truncated/engineered analogs (e.g., KR-12, FK-13, GF-17) and local/topical delivery are studied instead of broad systemic use.

BMechanism · antimicrobial

Membrane disruption & antibiofilm

LL-37's cationic, amphipathic helix permeabilizes anionic microbial membranes across Gram-positive and Gram-negative pathogens, and shows preclinical antibiofilm activity at sub-bactericidal concentrations — strong rationale that nonetheless did not translate into significant bacterial-colonization reduction in the DFU trial.

BMechanism · angiogenesis

Endothelial activation & neovascularization

LL-37 activates endothelial cells and promotes neovascularization in experimental models (FPR2-dependent, VEGF/PI3K–AKT), supporting granulation-tissue formation — one of the mechanistic legs under the chronic-wound research lane.

CMechanism · immune bridging

Chemotaxis, NETs & LPS neutralization

As an alarmin, LL-37 chemoattracts neutrophils, monocytes, and T cells via FPR2/FPRL1 and is a component of neutrophil extracellular traps, while binding and neutralizing LPS — mechanistic immune bridging, not a sepsis-therapy claim.

C · RiskSafety · cancer biology

Context-dependent tumor biology

LL-37 shows pro-tumor effects in some cancers and suppressive effects in others, depending on tissue and pathway — contradictory enough that Intrasigna blocks any anti-cancer (or pro-tumor-risk) representation and treats active malignancy as an exclusion.

ABiology · expression

Where LL-37 is made & secreted

hCAP18/LL-37 is expressed in neutrophils and squamous epithelia (airway, mouth, esophagus, intestine) and secreted in sweat, saliva, wound fluid, and seminal plasma, with roles in respiratory, oral, and antimycobacterial surface defense — its broad endogenous footprint.

CMechanism · RNA sensing

RNA presentation to scavenger receptors

Sequence determinants in LL-37 let it present RNA to scavenger receptors such as SR-B1 on keratinocytes, forming ordered supramolecular complexes that potentiate type-I-interferon responses — extending the self-nucleic-acid immune-amplification mechanism beyond pDCs.

DAdmin · gating rule

Research-only gating & eligibility engine

Intrasigna publishes LL-37 with human dosing blocked and only source-backed topical trial arms displayed, behind route, wound-type, infection-severity, vascular, autoimmune, and cancer gates — including vascular assessment (DFU ABI 0.9–1.3) and exclusion of severe/deep infection and osteomyelitis.

07 · Compare & contrast

Where LL-37 sits among repair & defense peptides.

LL-37 is often grouped with wound-repair peptides like BPC-157, TB-500, and GHK-Cu, and with antimicrobial peptides like the defensins. The distinction that matters: LL-37 is an immune-active host-defense peptide with genuine human topical wound data but a hard autoimmune/cancer risk profile — so it is gated far more tightly than the popular "wound-repair stack" peptides, and combining them is not source-backed.

FeatureLL-37Wound-repair peptides (BPC-157 / TB-500 / GHK-Cu)
Primary identityHuman cathelicidin / antimicrobialRepair / regenerative peptides
Antimicrobial actionYes (direct, antibiofilm)No (not antimicrobial)
Immune signalingStrong, bidirectionalLimited / different
Human wound trialsTopical VLU/DFU (mixed)Largely preclinical/anecdotal
Autoimmune riskHigh (psoriasis/lupus)Low / not characterized
Cancer-context concernYes (bidirectional)Variable / less defined
Human dosing in atlasBlocked (topical trial-arm display)Varies (own gating)
Intrasigna stackingBlocked without reviewPer-page gating
L2 · antimicrobial-peptide context
LL-37 vs other host-defense peptides
PeptideFamilyNote
LL-37Cathelicidin (only human one)Cysteine-free α-helix; immune-active
α-/β-defensinsDefensinsCysteine-rich, disulfide-bonded
KR-12 / FK-13 / GF-17LL-37 fragmentsEngineered for activity/lower toxicity
HistatinsSalivary AMPsOral-cavity defense/repair

Related peptides.

09 · Reading-layer ledes

The same peptide, three depths.

L1 · Consumer — LL-37 is a natural immune peptide your body makes to defend skin and surfaces against microbes and to help wounds heal. The most credible human research is topical wound care — leg and diabetic foot ulcers — and even there results are mixed. It is not a general "immune booster," and there is no safe public dose: injectable, systemic, oral, and nasal uses are blocked. It can also worsen immune/inflammatory conditions like psoriasis, so it needs medical oversight.
L2 · Clinical — LL-37 is the only human cathelicidin, a pleiotropic host-defense peptide with antimicrobial, antibiofilm, chemotactic, LPS-neutralizing, angiogenic, epithelial-repair, and immunomodulatory effects. Human evidence is topical-wound only and mixed (positive 2014 VLU RCT; non-significant HEAL phase-IIb full cohort; DFU RCT improved granulation but not cytokines/bacteria). It is hard-gated: route, wound-type, infection severity, perfusion, autoimmune, and cancer gates apply, with provider/IRB review required and human dosing output blocked.
L3 · Research — LL-37 ([LL-37, 37 aa]; 37-aa, +6, amphipathic α-helix from hCAP18/CAMP via proteinase 3) disrupts microbial membranes, neutralizes LPS, drives FPR2 chemotaxis and EGFR-mediated keratinocyte migration, and promotes angiogenesis — while forming self-DNA/RNA complexes that activate pDC TLR9/TLR7 → type-I IFN, the basis of its psoriasis/lupus risk and context-dependent cancer biology. Therapeutic development is constrained by eukaryotic cytotoxicity and proteolytic instability, motivating topical delivery and engineered fragments (KR-12, FK-13, GF-17). Vitamin D/VDR directly induces CAMP expression.
08 · References & evidence

Source register.

Evidence grades reflect the strength of support for the specific claim cited, not the prestige of the journal. LL-37's identity and core mechanisms are well supported; the topical VLU/DFU trials are the firmest human dosing-context sources (and are presented with their negatives); immune-risk, cancer-context, and development-limitation sources anchor the hard safety gating.

A · Established biology / identity
B · Human trial / strong mechanism
C · Preclinical / mixed / risk
D · Contradictory / unsupported
P · Mechanistic inference
Explore the ATLAS index

More Repair / Immune peptides & tools.